SCOPe 2.08: Domain d2c7fe1: 2c7f E:3-16,E:387-502

Lineage for d2c7fe1 (2c7f E:3-16,E:387-502)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Alpha-l-arabinofuranosidase [101924] (2 species)
   glycosyl hydrolase family 51

7. Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries)
   Uniprot Q4CJG5 2-16,387-502

8. Domain d2c7fe1: 2c7f E:3-16,E:387-502 [130063]
   Other proteins in same PDB: d2c7fa2, d2c7fb2, d2c7fc2, d2c7fd2, d2c7fe2, d2c7ff2
   automated match to d2c7fa1
   complexed with edo

Details for d2c7fe1

PDB Entry: 2c7f, 2.7 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.

PDB Compounds: (E:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d2c7fe1:

Sequence, based on SEQRES records:

>d2c7fe1 b.71.1.2 (E:3-16,E:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
karmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrn
ihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsml
rraswnvirig

Sequence, based on observed residues (ATOM records):

>d2c7fe1 b.71.1.2 (E:3-16,E:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
karmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrn
ihedivlvsdvrgrllehivlehqdlkirnsvngeevypknsdkssiltsmlrraswnvi
rig

Timeline for d2c7fe1:

• d2c7fe1 first appeared in SCOP 1.73
  
• d2c7fe1 appears in SCOPe 2.07