Lineage for d2c7fd2 (2c7f D:17-386)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439246Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
    glycosyl hydrolase family 51
  7. 2439258Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries)
    Uniprot Q4CJG5 17-386
  8. 2439268Domain d2c7fd2: 2c7f D:17-386 [130062]
    Other proteins in same PDB: d2c7fa1, d2c7fb1, d2c7fc1, d2c7fd1, d2c7fe1, d2c7ff1
    automated match to d2c7fa2
    complexed with ahr, edo

Details for d2c7fd2

PDB Entry: 2c7f (more details), 2.7 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.
PDB Compounds: (D:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d2c7fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7fd2 c.1.8.3 (D:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]}
idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn
yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac
nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta
ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl
aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap
pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify
pfmhaskygr

SCOPe Domain Coordinates for d2c7fd2:

Click to download the PDB-style file with coordinates for d2c7fd2.
(The format of our PDB-style files is described here.)

Timeline for d2c7fd2: