SCOP 1.75: Domain d2c7fc2: 2c7f C:17-386

Lineage for d2c7fc2 (2c7f C:17-386)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (26 proteins)
   consist of a number of sequence families

6. Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
   glycosyl hydrolase family 51

7. Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries)
   Uniprot Q4CJG5 17-386

8. Domain d2c7fc2: 2c7f C:17-386 [130060]
   Other proteins in same PDB: d2c7fa1, d2c7fb1, d2c7fc1, d2c7fd1, d2c7fe1, d2c7ff1
   automatically matched to 2C7F A:17-386
   complexed with ahr, edo; mutant

Details for d2c7fc2

PDB Entry: 2c7f, 2.7 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.

PDB Compounds: (C:) alpha-l-arabinofuranosidase

SCOP Domain Sequences for d2c7fc2:

Sequence; same for both SEQRES and ATOM records:

>d2c7fc2 c.1.8.3 (C:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]}
idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn
yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac
nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta
ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl
aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap
pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify
pfmhaskygr

Timeline for d2c7fc2:

• d2c7fc2 first appeared in SCOP 1.73
  
• d2c7fc2 appears in SCOPe 2.01
  
• d2c7fc2 appears in the current release, SCOPe 2.08