![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
![]() | Protein Chaperonin-10 (GroES) [50131] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50132] (7 PDB entries) |
![]() | Domain d2c7du1: 2c7d U:3-95 [130054] automatically matched to d1aono_ |
PDB Entry: 2c7d (more details), 8.7 Å
SCOPe Domain Sequences for d2c7du1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7du1 b.35.1.1 (U:3-95) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} irplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvkvg divifndgygvksekidneevlimsesdilaiv
Timeline for d2c7du1: