Lineage for d2c79a1 (2c79 A:480-683)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689577Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (7 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 689615Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (6 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 689640Protein Xylanase XynA C-terminal domain [141955] (1 species)
  7. 689641Species Clostridium thermocellum [TaxId:1515] [141956] (2 PDB entries)
  8. 689643Domain d2c79a1: 2c79 A:480-683 [130040]
    automatically matched to 2C71 A:480-683
    complexed with co

Details for d2c79a1

PDB Entry: 2c79 (more details), 1.5 Å

PDB Description: the structure of a family 4 acetyl xylan esterase from clostridium thermocellum in complex with a colbalt ion.
PDB Compounds: (A:) glycoside hydrolase, family 11:clostridium cellulosome enzyme, dockerin type I:polysaccharide deacetylase:carbohydrate binding module, family 6

SCOP Domain Sequences for d2c79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c79a1 c.6.2.3 (A:480-683) Xylanase XynA C-terminal domain {Clostridium thermocellum [TaxId: 1515]}
klvaltfddgpdnvltarvldkldkynvkatfmvvgqrvndstaaiirrmvnsgheignh
swsysgmanmspdqirksiadtnaviqkyagttpkffrppnletsptlfnnvdlvfvggl
tandwipsttaeqraaavingvrdgtiillhdvqpephptpealdiiiptlksrgyefvt
ltelftlkgvpidpsvkrmynsvp

SCOP Domain Coordinates for d2c79a1:

Click to download the PDB-style file with coordinates for d2c79a1.
(The format of our PDB-style files is described here.)

Timeline for d2c79a1: