SCOPe 2.08: Domain d2c79a2: 2c79 A:480-683

Lineage for d2c79a2 (2c79 A:480-683)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456

6. Protein automated matches [190086] (3 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187519] (1 PDB entry)

8. Domain d2c79a2: 2c79 A:480-683 [130040]
   Other proteins in same PDB: d2c79a3
   automated match to d2c71a1
   complexed with co

Details for d2c79a2

PDB Entry: 2c79, 1.5 Å

PDB Description: the structure of a family 4 acetyl xylan esterase from clostridium thermocellum in complex with a colbalt ion.

PDB Compounds: (A:) glycoside hydrolase, family 11:clostridium cellulosome enzyme, dockerin type I:polysaccharide

SCOPe Domain Sequences for d2c79a2:

Sequence; same for both SEQRES and ATOM records:

>d2c79a2 c.6.2.3 (A:480-683) automated matches {Clostridium thermocellum [TaxId: 1515]}
klvaltfddgpdnvltarvldkldkynvkatfmvvgqrvndstaaiirrmvnsgheignh
swsysgmanmspdqirksiadtnaviqkyagttpkffrppnletsptlfnnvdlvfvggl
tandwipsttaeqraaavingvrdgtiillhdvqpephptpealdiiiptlksrgyefvt
ltelftlkgvpidpsvkrmynsvp

Timeline for d2c79a2:

• d2c79a2 first appeared in SCOP 1.73, called d2c79a1
  
• d2c79a2 appears in SCOPe 2.07