Lineage for d2c78a1 (2c78 A:213-312)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801311Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 801340Species Thermus thermophilus [TaxId:274] [50452] (7 PDB entries)
  8. 801341Domain d2c78a1: 2c78 A:213-312 [130037]
    Other proteins in same PDB: d2c78a2, d2c78a3
    automatically matched to d1aipa1
    complexed with gnp, mg, pul

Details for d2c78a1

PDB Entry: 2c78 (more details), 1.4 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic pulvomycin
PDB Compounds: (A:) elongation factor tu-a

SCOP Domain Sequences for d2c78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d2c78a1:

Click to download the PDB-style file with coordinates for d2c78a1.
(The format of our PDB-style files is described here.)

Timeline for d2c78a1: