![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
![]() | Species Thermus thermophilus [TaxId:274] [50452] (7 PDB entries) |
![]() | Domain d2c78a1: 2c78 A:213-312 [130037] Other proteins in same PDB: d2c78a2, d2c78a3 automatically matched to d1aipa1 complexed with gnp, mg, pul |
PDB Entry: 2c78 (more details), 1.4 Å
SCOP Domain Sequences for d2c78a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d2c78a1: