Lineage for d2c77a3 (2c77 A:9-212)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830208Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 830239Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)
  8. 830241Domain d2c77a3: 2c77 A:9-212 [130036]
    Other proteins in same PDB: d2c77a1, d2c77a2
    automatically matched to d1aipa3
    complexed with gea, gnp, mg, peg

Details for d2c77a3

PDB Entry: 2c77 (more details), 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a
PDB Compounds: (A:) Elongation factor Tu-B

SCOP Domain Sequences for d2c77a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c77a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d2c77a3:

Click to download the PDB-style file with coordinates for d2c77a3.
(The format of our PDB-style files is described here.)

Timeline for d2c77a3: