SCOPe 2.05: Domain d2c77a2: 2c77 A:313-405

Lineage for d2c77a2 (2c77 A:313-405)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (14 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255084] (2 PDB entries)

8. Domain d2c77a2: 2c77 A:313-405 [130035]
   Other proteins in same PDB: d2c77a1, d2c77a3
   automated match to d1b23p2
   complexed with gnp, mg, peg

Details for d2c77a2

PDB Entry: 2c77, 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a

PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a2:

Sequence; same for both SEQRES and ATOM records:

>d2c77a2 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d2c77a2:

• d2c77a2 first appeared in SCOP 1.73
  
• d2c77a2 appears in SCOPe 2.04
  
• d2c77a2 appears in SCOPe 2.06
  
• d2c77a2 appears in the current release, SCOPe 2.08