Lineage for d2c77a2 (2c77 A:313-405)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317760Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1317761Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1317789Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1317821Species Thermus thermophilus [TaxId:274] [50470] (6 PDB entries)
  8. 1317823Domain d2c77a2: 2c77 A:313-405 [130035]
    Other proteins in same PDB: d2c77a1, d2c77a3
    automatically matched to d1aipa2
    complexed with gnp, mg, peg

Details for d2c77a2

PDB Entry: 2c77 (more details), 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a
PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c77a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d2c77a2:

Click to download the PDB-style file with coordinates for d2c77a2.
(The format of our PDB-style files is described here.)

Timeline for d2c77a2: