Class b: All beta proteins [48724] (174 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Thermus thermophilus [TaxId:274] [50470] (6 PDB entries) |
Domain d2c77a2: 2c77 A:313-405 [130035] Other proteins in same PDB: d2c77a1, d2c77a3 automatically matched to d1aipa2 complexed with gnp, mg, peg |
PDB Entry: 2c77 (more details), 1.6 Å
SCOPe Domain Sequences for d2c77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c77a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d2c77a2: