![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (29 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255083] (2 PDB entries) |
![]() | Domain d2c77a1: 2c77 A:213-312 [130034] Other proteins in same PDB: d2c77a2, d2c77a3 automated match to d1b23p1 complexed with gnp, mg, peg |
PDB Entry: 2c77 (more details), 1.6 Å
SCOPe Domain Sequences for d2c77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c77a1 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d2c77a1: