SCOPe 2.04: Domain d2c77a1: 2c77 A:213-312

Lineage for d2c77a1 (2c77 A:213-312)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (16 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255083] (2 PDB entries)

8. Domain d2c77a1: 2c77 A:213-312 [130034]
   Other proteins in same PDB: d2c77a2, d2c77a3
   automated match to d1b23p1
   complexed with gnp, mg, peg

Details for d2c77a1

PDB Entry: 2c77, 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a

PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a1:

Sequence; same for both SEQRES and ATOM records:

>d2c77a1 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

Timeline for d2c77a1:

• d2c77a1 first appeared in SCOP 1.73
  
• d2c77a1 appears in SCOPe 2.03
  
• d2c77a1 appears in SCOPe 2.05
  
• d2c77a1 appears in the current release, SCOPe 2.08