Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries) |
Domain d2c72a2: 2c72 A:290-401 [130019] Other proteins in same PDB: d2c72a1, d2c72b1 automatically matched to d1o5wa2 complexed with fad, rsa; mutant |
PDB Entry: 2c72 (more details), 2 Å
SCOPe Domain Sequences for d2c72a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c72a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d2c72a2: