SCOP 1.73: Domain d2c72a2: 2c72 A:290-401

Lineage for d2c72a2 (2c72 A:290-401)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries)

8. Domain d2c72a2: 2c72 A:290-401 [130019]
   Other proteins in same PDB: d2c72a1, d2c72b1
   automatically matched to d1o5wa2
   complexed with fad, rsa; mutant

Details for d2c72a2

PDB Entry: 2c72, 2 Å

PDB Description: functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins

PDB Compounds: (A:) amine oxidase (flavin-containing) b

SCOP Domain Sequences for d2c72a2:

Sequence; same for both SEQRES and ATOM records:

>d2c72a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d2c72a2:

• d2c72a2 is new in SCOP 1.73
  
• d2c72a2 appears in SCOP 1.75
  
• d2c72a2 appears in the current release, SCOPe 2.08