SCOPe 2.03: Domain d2c72a1: 2c72 A:6-289,A:402-500

Lineage for d2c72a1 (2c72 A:6-289,A:402-500)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Monoamine oxidase B [69423] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69424] (37 PDB entries)

8. Domain d2c72a1: 2c72 A:6-289,A:402-500 [130018]
   Other proteins in same PDB: d2c72a2, d2c72b2
   automatically matched to d1o5wc1
   complexed with fad, rsa; mutant

Details for d2c72a1

PDB Entry: 2c72, 2 Å

PDB Description: functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins

PDB Compounds: (A:) amine oxidase (flavin-containing) b

SCOPe Domain Sequences for d2c72a1:

Sequence; same for both SEQRES and ATOM records:

>d2c72a1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq
nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm
greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf
lwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv
lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq
pvdriyfagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqp
itttflerhlpsvpgllrligltt

Timeline for d2c72a1:

• d2c72a1 first appeared in SCOP 1.73
  
• d2c72a1 appears in SCOPe 2.02
  
• d2c72a1 appears in SCOPe 2.04
  
• d2c72a1 appears in the current release, SCOPe 2.08