Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Monoamine oxidase B [69423] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [102180] (14 PDB entries) |
Domain d2c72a1: 2c72 A:6-289,A:402-500 [130018] Other proteins in same PDB: d2c72a2, d2c72b2 automatically matched to d1o5wc1 complexed with fad, rsa; mutant |
PDB Entry: 2c72 (more details), 2 Å
SCOPe Domain Sequences for d2c72a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c72a1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Norway rat (Rattus norvegicus) [TaxId: 10116]} dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf lwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq pvdriyfagtetathwsghmegaveageraareilhamgkipedeiwqsepesvdvpaqp itttflerhlpsvpgllrligltt
Timeline for d2c72a1: