SCOPe 2.07: Domain d2c6ya_: 2c6y A:

Lineage for d2c6ya_ (2c6y A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d2c6ya_: 2c6y A: [130011]
   automated match to d1jxsa_
   complexed with mg

Details for d2c6ya_

PDB Entry: 2c6y, 2.4 Å

PDB Description: crystal structure of interleukin enhancer-binding factor 1 bound to dna

PDB Compounds: (A:) forkhead box protein k2

SCOPe Domain Sequences for d2c6ya_:

Sequence; same for both SEQRES and ATOM records:

>d2c6ya_ a.4.5.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpasesklieqafrkrrpr

Timeline for d2c6ya_:

• d2c6ya_ first appeared in SCOP 1.73, called d2c6ya1
  
• d2c6ya_ appears in SCOPe 2.06
  
• d2c6ya_ appears in the current release, SCOPe 2.08