Lineage for d2c6tb1 (2c6t B:181-308)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644107Domain d2c6tb1: 2c6t B:181-308 [130005]
    Other proteins in same PDB: d2c6ta1, d2c6tc1
    automatically matched to d1vin_1
    complexed with dt5

Details for d2c6tb1

PDB Entry: 2c6t (more details), 2.61 Å

PDB Description: crystal structure of the human cdk2 complexed with the triazolopyrimidine inhibitor
PDB Compounds: (B:) cyclin a2

SCOP Domain Sequences for d2c6tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6tb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOP Domain Coordinates for d2c6tb1:

Click to download the PDB-style file with coordinates for d2c6tb1.
(The format of our PDB-style files is described here.)

Timeline for d2c6tb1: