Lineage for d2c6ja1 (2c6j A:15-308)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016275Protein Duffy receptor, alpha form [140926] (1 species)
  7. 2016276Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [140927] (1 PDB entry)
    Uniprot P22545 213-506
  8. 2016277Domain d2c6ja1: 2c6j A:15-308 [129996]

Details for d2c6ja1

PDB Entry: 2c6j (more details), 3 Å

PDB Description: structure of p. knowlesi dbl domain capable of binding human duffy antigen
PDB Compounds: (A:) duffy receptor, alpha form

SCOPe Domain Sequences for d2c6ja1:

Sequence, based on SEQRES records: (download)

>d2c6ja1 a.264.1.1 (A:15-308) Duffy receptor, alpha form {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlvnntrthshnditflklnlkrk
lmydaavegdlllkknnyqynkefckdirwglgdfgdiimgtnmegigysqvvennlrsi
fgtdekakqdrkqwwneskehiwrammfslrsrlkekfvwickkdvtlkvepqiyrwire
wgrdymselpkeqgklnekcasklyynnmaicmlplchdacksydqwitrkkkqwdvlst
kfssvkktqkigteniataydilkqelngfkeatfeneinkrdnlynhlcpcvv

Sequence, based on observed residues (ATOM records): (download)

>d2c6ja1 a.264.1.1 (A:15-308) Duffy receptor, alpha form {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
kcndkrkrgerdwdcpaekdicisdrryqlcmkeltnlitflklnlkrklmydaavegdl
llkknnyqynkefckdirwglgdfgdiimgtnmegvennlrsifgtdekakqdrkqwwne
skehiwrammfslrsrlkekfvwickkdvpqiyrwirewgrdymselpkeqgklnekcas
klyynnmaicmlplchdacksydqwitrkkkqwdvlstkfssvkktniataydilkqeln
gfkeatfeneinkrdnlynhlcpcvv

SCOPe Domain Coordinates for d2c6ja1:

Click to download the PDB-style file with coordinates for d2c6ja1.
(The format of our PDB-style files is described here.)

Timeline for d2c6ja1: