SCOP 1.73: Domain d2c6ga2: 2c6g A:118-350

Lineage for d2c6ga2 (2c6g A:118-350)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.4: PA domain [52025] (1 family)

5. Family c.8.4.1: PA domain [52026] (2 proteins)

6. Protein Glutamate carboxypeptidase II [141984] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141985] (11 PDB entries)

8. Domain d2c6ga2: 2c6g A:118-350 [129993]
   Other proteins in same PDB: d2c6ga1, d2c6ga3
   automatically matched to 2C6C A:118-350
   complexed with bma, ca, cl, glu, man, nag, zn

Details for d2c6ga2

PDB Entry: 2c6g, 2.2 Å

PDB Description: membrane-bound glutamate carboxypeptidase ii (gcpii) with bound glutamate

PDB Compounds: (A:) glutamate carboxypeptidase II

SCOP Domain Sequences for d2c6ga2:

Sequence, based on SEQRES records:

>d2c6ga2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Sequence, based on observed residues (ATOM records):

>d2c6ga2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgfqkvkmhihstn

Timeline for d2c6ga2:

• d2c6ga2 is new in SCOP 1.73
  
• d2c6ga2 appears in SCOP 1.75
  
• d2c6ga2 appears in the current release, SCOPe 2.08