Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins) |
Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species) Folate hydrolase 1, FolH homologue |
Species Human (Homo sapiens) [TaxId:9606] [142523] (34 PDB entries) Uniprot Q04609 57-117,351-593 |
Domain d2c6ca3: 2c6c A:57-117,A:351-593 [129991] Other proteins in same PDB: d2c6ca1, d2c6ca2 complexed with 24i, ca, cl, nag, zn |
PDB Entry: 2c6c (more details), 2 Å
SCOPe Domain Sequences for d2c6ca3:
Sequence, based on SEQRES records: (download)
>d2c6ca3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]} nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl giasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfela nsivl
>d2c6ca3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]} nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl giasgrarytknsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivl
Timeline for d2c6ca3: