![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (1 family) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
![]() | Protein MDM2 [144198] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144199] (2 PDB entries) Uniprot Q00987 290-335 |
![]() | Domain d2c6ba1: 2c6b A:290-335 [129988] automatically matched to 2C6A A:290-335 complexed with zn |
PDB Entry: 2c6b (more details)
SCOPe Domain Sequences for d2c6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c6ba1 g.41.11.1 (A:290-335) MDM2 {Human (Homo sapiens) [TaxId: 9606]} sfeedpeisladywkctscnemnpplpshcnrcwalrenwlpedkg
Timeline for d2c6ba1: