| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
| Protein Monoamine oxidase B [69673] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries) |
| Domain d2c65b2: 2c65 B:290-401 [129976] Other proteins in same PDB: d2c65a1, d2c65b1 automatically matched to d1o5wa2 complexed with 4cr, fad |
PDB Entry: 2c65 (more details), 1.7 Å
SCOP Domain Sequences for d2c65b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c65b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d2c65b2: