Lineage for d2c65b1 (2c65 B:3-289,B:402-496)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457810Protein Monoamine oxidase B [69423] (2 species)
  7. 2457811Species Human (Homo sapiens) [TaxId:9606] [69424] (46 PDB entries)
  8. 2457827Domain d2c65b1: 2c65 B:3-289,B:402-496 [129975]
    Other proteins in same PDB: d2c65a2, d2c65b2
    automated match to d1s3ea1
    complexed with 4cr, fad

Details for d2c65b1

PDB Entry: 2c65 (more details), 1.7 Å

PDB Description: mao inhibition by rasagiline analogues
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2c65b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c65b1 c.3.1.2 (B:3-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrli

SCOPe Domain Coordinates for d2c65b1:

Click to download the PDB-style file with coordinates for d2c65b1.
(The format of our PDB-style files is described here.)

Timeline for d2c65b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c65b2