Lineage for d2c64b2 (2c64 B:290-401)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718307Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 718308Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 718491Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 718515Protein Monoamine oxidase B [69673] (2 species)
  7. 718545Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries)
  8. 718565Domain d2c64b2: 2c64 B:290-401 [129972]
    Other proteins in same PDB: d2c64a1, d2c64b1
    automatically matched to d1o5wa2
    complexed with fad, ma0

Details for d2c64b2

PDB Entry: 2c64 (more details), 2.2 Å

PDB Description: mao inhibition by rasagiline analogues
PDB Compounds: (B:) amine oxidase (flavin-containing) b

SCOP Domain Sequences for d2c64b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c64b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d2c64b2:

Click to download the PDB-style file with coordinates for d2c64b2.
(The format of our PDB-style files is described here.)

Timeline for d2c64b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c64b1