Lineage for d2c64a1 (2c64 A:6-289,A:402-500)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822426Protein Monoamine oxidase B [69423] (2 species)
  7. 822466Species Rat (Rattus norvegicus) [TaxId:10116] [102180] (14 PDB entries)
  8. 822485Domain d2c64a1: 2c64 A:6-289,A:402-500 [129969]
    Other proteins in same PDB: d2c64a2, d2c64b2
    automatically matched to d1o5wc1
    complexed with fad, ma0

Details for d2c64a1

PDB Entry: 2c64 (more details), 2.2 Å

PDB Description: mao inhibition by rasagiline analogues
PDB Compounds: (A:) amine oxidase (flavin-containing) b

SCOP Domain Sequences for d2c64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c64a1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq
nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm
greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf
lwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv
lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq
pvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqp
itttflerhlpsvpgllrligltt

SCOP Domain Coordinates for d2c64a1:

Click to download the PDB-style file with coordinates for d2c64a1.
(The format of our PDB-style files is described here.)

Timeline for d2c64a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c64a2