SCOPe 2.05: Domain d2c62b_: 2c62 B:

Lineage for d2c62b_ (2c62 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.1: Transcriptional coactivator PC4 C-terminal domain [54448] (1 protein)
   dimer of two separate motifs
   automatically mapped to Pfam PF02229

6. Protein Transcriptional coactivator PC4 C-terminal domain [54449] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54450] (3 PDB entries)

8. Domain d2c62b_: 2c62 B: [129968]
   automated match to d1pcfa_
   protein/DNA complex; complexed with so4

Details for d2c62b_

PDB Entry: 2c62, 1.74 Å

PDB Description: crystal structure of the human transcription cofactor pc4 in complex with single-stranded dna

PDB Compounds: (B:) activated RNA polymerase II transcriptional coactivator p15

SCOPe Domain Sequences for d2c62b_:

Sequence; same for both SEQRES and ATOM records:

>d2c62b_ d.18.1.1 (B:) Transcriptional coactivator PC4 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
amfqigkmryvsvrdfkgkvlidireywmdpegemkpgrkgislnpeqwsqlkeqisdid
davrkl

Timeline for d2c62b_:

• d2c62b_ first appeared in SCOP 1.73, called d2c62b1
  
• d2c62b_ appears in SCOPe 2.04
  
• d2c62b_ is called d2c62b2 in SCOPe 2.06
  
• d2c62b_ appears in the current release, SCOPe 2.08, called d2c62b2