Lineage for d2c60a1 (2c60 A:43-122)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179003Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2179019Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2179041Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species)
  7. 2179042Species Human (Homo sapiens) [TaxId:9606] [142979] (3 PDB entries)
    Uniprot Q99759 42-123! Uniprot Q99759 43-122
  8. 2179043Domain d2c60a1: 2c60 A:43-122 [129966]
    Other proteins in same PDB: d2c60a2
    complexed with ca, gol

Details for d2c60a1

PDB Entry: 2c60 (more details), 1.25 Å

PDB Description: crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
PDB Compounds: (A:) human mitogen-activated protein kinase kinase kinase 3 isoform 2

SCOPe Domain Sequences for d2c60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c60a1 d.15.2.2 (A:43-122) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]}
sdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddldk
aidildrsssmkslrillls

SCOPe Domain Coordinates for d2c60a1:

Click to download the PDB-style file with coordinates for d2c60a1.
(The format of our PDB-style files is described here.)

Timeline for d2c60a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c60a2