Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142979] (3 PDB entries) Uniprot Q99759 42-123! Uniprot Q99759 43-122 |
Domain d2c60a1: 2c60 A:43-122 [129966] Other proteins in same PDB: d2c60a2 complexed with ca, gol |
PDB Entry: 2c60 (more details), 1.25 Å
SCOPe Domain Sequences for d2c60a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c60a1 d.15.2.2 (A:43-122) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]} sdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddldk aidildrsssmkslrillls
Timeline for d2c60a1: