Lineage for d2c5xb2 (2c5x B:309-432)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644128Domain d2c5xb2: 2c5x B:309-432 [129961]
    Other proteins in same PDB: d2c5xa1, d2c5xc1
    automatically matched to d1vin_2
    complexed with mtw

Details for d2c5xb2

PDB Entry: 2c5x (more details), 2.9 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
PDB Compounds: (B:) cyclin a2

SCOP Domain Sequences for d2c5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5xb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d2c5xb2:

Click to download the PDB-style file with coordinates for d2c5xb2.
(The format of our PDB-style files is described here.)

Timeline for d2c5xb2: