Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
Domain d2c5xb2: 2c5x B:310-432 [129961] Other proteins in same PDB: d2c5xa_, d2c5xc_ automated match to d1h27b2 complexed with mtw |
PDB Entry: 2c5x (more details), 2.9 Å
SCOPe Domain Sequences for d2c5xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5xb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d2c5xb2:
View in 3D Domains from other chains: (mouse over for more information) d2c5xa_, d2c5xc_, d2c5xd1, d2c5xd2 |