Lineage for d2c5wb1 (2c5w B:266-650)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742523Protein Penicillin-binding protein 1a, transpeptidase domain [144034] (1 species)
  7. 742524Species Streptococcus pneumoniae [TaxId:1313] [144035] (2 PDB entries)
  8. 742525Domain d2c5wb1: 2c5w B:266-650 [129958]
    complexed with cl, edo, pcz, zn

Details for d2c5wb1

PDB Entry: 2c5w (more details), 2.55 Å

PDB Description: penicillin-binding protein 1a (pbp-1a) acyl-enzyme complex (cefotaxime) from streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 1a

SCOP Domain Sequences for d2c5wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]}
snypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdd
elqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleyg
vyestativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnra
ktflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkv
vfsdgsekefsnvgtramkettaymmtdmmktvltygtgrnaylawlpqagktgtsnytd
eeienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyl
segsnpedwnipeglyrngefvfkn

SCOP Domain Coordinates for d2c5wb1:

Click to download the PDB-style file with coordinates for d2c5wb1.
(The format of our PDB-style files is described here.)

Timeline for d2c5wb1: