SCOPe 2.08: Domain d2c5wb1: 2c5w B:266-650

Lineage for d2c5wb1 (2c5w B:266-650)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Penicillin-binding protein 1a, transpeptidase domain [144034] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144035] (2 PDB entries)
   Uniprot Q8DR59 266-650! Uniprot Q8DR59 267-650

8. Domain d2c5wb1: 2c5w B:266-650 [129958]
   complexed with cef, cl, edo, zn

Details for d2c5wb1

PDB Entry: 2c5w, 2.55 Å

PDB Description: penicillin-binding protein 1a (pbp-1a) acyl-enzyme complex (cefotaxime) from streptococcus pneumoniae

PDB Compounds: (B:) penicillin-binding protein 1a

SCOPe Domain Sequences for d2c5wb1:

Sequence; same for both SEQRES and ATOM records:

>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdd
elqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleyg
vyestativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnra
ktflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkv
vfsdgsekefsnvgtramkettaymmtdmmktvltygtgrnaylawlpqagktgtsnytd
eeienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyl
segsnpedwnipeglyrngefvfkn

Timeline for d2c5wb1:

• d2c5wb1 first appeared in SCOP 1.73
  
• d2c5wb1 appears in SCOPe 2.07