Lineage for d2c5sa1 (2c5s A:174-391)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469798Family c.26.2.6: ThiI-like [142093] (2 proteins)
    Pfam PF02568
  6. 2469803Protein Thiamine biosynthesis protein ThiI, C-terminal domain [142094] (1 species)
  7. 2469804Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142095] (1 PDB entry)
    Uniprot Q81KU0 174-391
  8. 2469805Domain d2c5sa1: 2c5s A:174-391 [129950]
    Other proteins in same PDB: d2c5sa2
    complexed with amp

Details for d2c5sa1

PDB Entry: 2c5s (more details), 2.5 Å

PDB Description: crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain
PDB Compounds: (A:) probable thiamine biosynthesis protein thii

SCOPe Domain Sequences for d2c5sa1:

Sequence, based on SEQRES records: (download)

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky
ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv
asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpyedcctvftpasp
atkpkrekanrfeakydftplideavanketmvlqtve

Sequence, based on observed residues (ATOM records): (download)

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky
ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv
asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpykpkrekanrfea
kydftplideavanketmvlqtve

SCOPe Domain Coordinates for d2c5sa1:

Click to download the PDB-style file with coordinates for d2c5sa1.
(The format of our PDB-style files is described here.)

Timeline for d2c5sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c5sa2