Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.6: ThiI-like [142093] (2 proteins) Pfam PF02568 |
Protein Thiamine biosynthesis protein ThiI, C-terminal domain [142094] (1 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142095] (1 PDB entry) Uniprot Q81KU0 174-391 |
Domain d2c5sa1: 2c5s A:174-391 [129950] Other proteins in same PDB: d2c5sa2 complexed with amp |
PDB Entry: 2c5s (more details), 2.5 Å
SCOPe Domain Sequences for d2c5sa1:
Sequence, based on SEQRES records: (download)
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpyedcctvftpasp atkpkrekanrfeakydftplideavanketmvlqtve
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpykpkrekanrfea kydftplideavanketmvlqtve
Timeline for d2c5sa1: