SCOPe 2.04: Domain d2c5sa1: 2c5s A:174-391

Lineage for d2c5sa1 (2c5s A:174-391)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.6: ThiI-like [142093] (2 proteins)
   Pfam PF02568

6. Protein Thiamine biosynthesis protein ThiI, C-terminal domain [142094] (1 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142095] (1 PDB entry)
   Uniprot Q81KU0 174-391

8. Domain d2c5sa1: 2c5s A:174-391 [129950]
   Other proteins in same PDB: d2c5sa2
   complexed with amp

Details for d2c5sa1

PDB Entry: 2c5s, 2.5 Å

PDB Description: crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain

PDB Compounds: (A:) probable thiamine biosynthesis protein thii

SCOPe Domain Sequences for d2c5sa1:

Sequence, based on SEQRES records:

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky
ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv
asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpyedcctvftpasp
atkpkrekanrfeakydftplideavanketmvlqtve

Sequence, based on observed residues (ATOM records):

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqeltky
ckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgeslgqv
asqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpykpkrekanrfea
kydftplideavanketmvlqtve

Timeline for d2c5sa1:

• d2c5sa1 first appeared in SCOP 1.73
  
• d2c5sa1 appears in SCOPe 2.03
  
• d2c5sa1 appears in SCOPe 2.05
  
• d2c5sa1 appears in the current release, SCOPe 2.08