SCOP 1.73: Domain d2c5rf1: 2c5r F:66-129

Lineage for d2c5rf1 (2c5r F:66-129)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.251.1: Phage replication organizer domain [140713] (1 family)
   DNA binding induces further oligomerization

5. Family a.251.1.1: Phage replication organizer domain [140714] (1 protein)
   Pfam PF06720

6. Protein Early protein gp16.7 [140715] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [140716] (3 PDB entries)

8. Domain d2c5rf1: 2c5r F:66-129 [129949]
   automatically matched to 2C5R A:66-129

Details for d2c5rf1

PDB Entry: 2c5r, 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna

PDB Compounds: (F:) early protein p16.7

SCOP Domain Sequences for d2c5rf1:

Sequence; same for both SEQRES and ATOM records:

>d2c5rf1 a.251.1.1 (F:66-129) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gslk

Timeline for d2c5rf1:

• d2c5rf1 is new in SCOP 1.73
  
• d2c5rf1 appears in SCOP 1.75
  
• d2c5rf1 appears in the current release, SCOPe 2.08, called d2c5rf_