Lineage for d2c5rc_ (2c5r C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
    automatically mapped to Pfam PF06720
  5. Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
    Pfam PF06720
  6. Protein automated matches [190518] (1 species)
    not a true protein
  7. Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries)
  8. Domain d2c5rc_: 2c5r C: [129946]
    Other proteins in same PDB: d2c5ra1
    automated match to d1zaea1
    protein/DNA complex

Details for d2c5rc_

PDB Entry: 2c5r (more details), 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
PDB Compounds: (C:) early protein p16.7

SCOPe Domain Sequences for d2c5rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5rc_ a.251.1.1 (C:) automated matches {Bacillus phage [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gslk

SCOPe Domain Coordinates for d2c5rc_ are not available.

Timeline for d2c5rc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c5ra1, d2c5rb_, d2c5rd_, d2c5re_, d2c5rf_