![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.251: Phage replication organizer domain [140712] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) ![]() DNA binding induces further oligomerization automatically mapped to Pfam PF06720 |
![]() | Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins) Pfam PF06720 |
![]() | Protein automated matches [190518] (1 species) not a true protein |
![]() | Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries) |
![]() | Domain d2c5rc_: 2c5r C: [129946] Other proteins in same PDB: d2c5ra1 automated match to d1zaea1 protein/DNA complex |
PDB Entry: 2c5r (more details), 2.9 Å
SCOPe Domain Sequences for d2c5rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5rc_ a.251.1.1 (C:) automated matches {Bacillus phage [TaxId: 10756]} nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr gslk
Timeline for d2c5rc_: