Lineage for d2c5ra1 (2c5r A:66-129)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780940Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 780941Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
  5. 780942Family a.251.1.1: Phage replication organizer domain [140714] (1 protein)
    Pfam PF06720
  6. 780943Protein Early protein gp16.7 [140715] (1 species)
  7. 780944Species Bacteriophage phi-29 [TaxId:10756] [140716] (3 PDB entries)
    Uniprot P16517 67-130
  8. 780945Domain d2c5ra1: 2c5r A:66-129 [129944]

Details for d2c5ra1

PDB Entry: 2c5r (more details), 2.9 Å

PDB Description: the structure of phage phi29 replication organizer protein p16.7 in complex with double stranded dna
PDB Compounds: (A:) early protein p16.7

SCOP Domain Sequences for d2c5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5ra1 a.251.1.1 (A:66-129) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gslk

SCOP Domain Coordinates for d2c5ra1:

Click to download the PDB-style file with coordinates for d2c5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2c5ra1: