![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (4 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries) |
![]() | Domain d2c5od1: 2c5o D:181-308 [129936] Other proteins in same PDB: d2c5oa1, d2c5oc1 automatically matched to d1vin_1 complexed with ck2 |
PDB Entry: 2c5o (more details), 2.1 Å
SCOP Domain Sequences for d2c5od1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5od1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2c5od1:
![]() Domains from other chains: (mouse over for more information) d2c5oa1, d2c5ob1, d2c5ob2, d2c5oc1 |