SCOPe 2.08: Domain d2c5ob1: 2c5o B:175-309

Lineage for d2c5ob1 (2c5o B:175-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d2c5ob1: 2c5o B:175-309 [129933]
   Other proteins in same PDB: d2c5oa_, d2c5oc_
   automated match to d1jsub1
   complexed with ck2

Details for d2c5ob1

PDB Entry: 2c5o, 2.1 Å

PDB Description: differential binding of inhibitors to active and inactive cdk2 provides insights for drug design

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2c5ob1:

Sequence; same for both SEQRES and ATOM records:

>d2c5ob1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d2c5ob1:

• d2c5ob1 first appeared in SCOP 1.73
  
• d2c5ob1 appears in SCOPe 2.07