Lineage for d2c5ld_ (2c5l D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540026Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2540168Protein automated matches [190541] (1 species)
    not a true protein
  7. 2540169Species Human (Homo sapiens) [TaxId:9606] [187513] (2 PDB entries)
  8. 2540170Domain d2c5ld_: 2c5l D: [129925]
    Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5lc1
    automated match to d2byfa1
    complexed with gol, gtp, mg

Details for d2c5ld_

PDB Entry: 2c5l (more details), 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras
PDB Compounds: (D:) phosphoinositide-specific phospholipase c plc-epsilon

SCOPe Domain Sequences for d2c5ld_:

Sequence, based on SEQRES records: (download)

>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeq

Sequence, based on observed residues (ATOM records): (download)

>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
sqrvlldqecvfkfilklkeq

SCOPe Domain Coordinates for d2c5ld_:

Click to download the PDB-style file with coordinates for d2c5ld_.
(The format of our PDB-style files is described here.)

Timeline for d2c5ld_: