SCOPe 2.06: Domain d2c5ld_: 2c5l D:

Lineage for d2c5ld_ (2c5l D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein automated matches [190541] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187513] (2 PDB entries)

8. Domain d2c5ld_: 2c5l D: [129925]
   Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5lc1
   automated match to d2byfa1
   complexed with gol, gtp, mg

Details for d2c5ld_

PDB Entry: 2c5l, 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras

PDB Compounds: (D:) phosphoinositide-specific phospholipase c plc-epsilon

SCOPe Domain Sequences for d2c5ld_:

Sequence, based on SEQRES records:

>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeq

Sequence, based on observed residues (ATOM records):

>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
sqrvlldqecvfkfilklkeq

Timeline for d2c5ld_:

• d2c5ld_ first appeared in SCOP 1.73, called d2c5ld1
  
• d2c5ld_ appears in SCOPe 2.05
  
• d2c5ld_ appears in SCOPe 2.07
  
• d2c5ld_ appears in the current release, SCOPe 2.08