![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins) contains Pfam PF00788 and Pfam PF02196 |
![]() | Protein Phospholipase C-epsilon-1 [142966] (1 species) contains several Ras-binding domains; some are 'hidden' in the sequence |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries) Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239 |
![]() | Domain d2c5ld1: 2c5l D:2134-2238 [129925] Other proteins in same PDB: d2c5la1, d2c5lb1 automatically matched to 2C5L C:2134-2239 complexed with gol, gtp, mg; mutant |
PDB Entry: 2c5l (more details), 1.9 Å
SCOP Domain Sequences for d2c5ld1:
Sequence, based on SEQRES records: (download)
>d2c5ld1 d.15.1.5 (D:2134-2238) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeq
>d2c5ld1 d.15.1.5 (D:2134-2238) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev sqrvlldqecvfkfilklkeq
Timeline for d2c5ld1: