Lineage for d2c5ld1 (2c5l D:2134-2238)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717441Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
    contains Pfam PF00788 and Pfam 02196
  6. 717469Protein Phospholipase C-epsilon-1 [142966] (1 species)
    contains several Ras-binding domains; some are 'hidden' in the sequence
  7. 717470Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
  8. 717472Domain d2c5ld1: 2c5l D:2134-2238 [129925]
    Other proteins in same PDB: d2c5la1, d2c5lb1
    automatically matched to 2C5L C:2134-2239
    complexed with gol, gtp, mg; mutant

Details for d2c5ld1

PDB Entry: 2c5l (more details), 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras
PDB Compounds: (D:) phosphoinositide-specific phospholipase c plc-epsilon

SCOP Domain Sequences for d2c5ld1:

Sequence, based on SEQRES records: (download)

>d2c5ld1 d.15.1.5 (D:2134-2238) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeq

Sequence, based on observed residues (ATOM records): (download)

>d2c5ld1 d.15.1.5 (D:2134-2238) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
sqrvlldqecvfkfilklkeq

SCOP Domain Coordinates for d2c5ld1:

Click to download the PDB-style file with coordinates for d2c5ld1.
(The format of our PDB-style files is described here.)

Timeline for d2c5ld1: