![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
![]() | Protein automated matches [190541] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187513] (2 PDB entries) |
![]() | Domain d2c5ld_: 2c5l D: [129925] Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5lc1 automated match to d2byfa1 complexed with gol, gtp, mg |
PDB Entry: 2c5l (more details), 1.9 Å
SCOPe Domain Sequences for d2c5ld_:
Sequence, based on SEQRES records: (download)
>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeq
>d2c5ld_ d.15.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev sqrvlldqecvfkfilklkeq
Timeline for d2c5ld_: