SCOPe 2.07: Domain d2c5lc1: 2c5l C:2134-2239

Lineage for d2c5lc1 (2c5l C:2134-2239)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein Phospholipase C-epsilon-1 [142966] (1 species)
   contains several Ras-binding domains; some are 'hidden' in the sequence

7. Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
   Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239

8. Domain d2c5lc1: 2c5l C:2134-2239 [129924]
   Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5ld_
   complexed with gol, gtp, mg

Details for d2c5lc1

PDB Entry: 2c5l, 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras

PDB Compounds: (C:) phosphoinositide-specific phospholipase c plc-epsilon

SCOPe Domain Sequences for d2c5lc1:

Sequence, based on SEQRES records:

>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqv

Sequence, based on observed residues (ATOM records):

>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdkssqrvlldqecvfqaqskwkgagkfilklkeqv

Timeline for d2c5lc1:

• d2c5lc1 first appeared in SCOP 1.73
  
• d2c5lc1 appears in SCOPe 2.06
  
• d2c5lc1 appears in the current release, SCOPe 2.08