Lineage for d2c5lc1 (2c5l C:2134-2239)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540026Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2540134Protein Phospholipase C-epsilon-1 [142966] (1 species)
    contains several Ras-binding domains; some are 'hidden' in the sequence
  7. 2540135Species Human (Homo sapiens) [TaxId:9606] [142967] (3 PDB entries)
    Uniprot Q9P212 2006-2114! Uniprot Q9P212 2131-2246! Uniprot Q9P212 2134-2239
  8. 2540136Domain d2c5lc1: 2c5l C:2134-2239 [129924]
    Other proteins in same PDB: d2c5la_, d2c5lb_, d2c5ld_
    complexed with gol, gtp, mg

Details for d2c5lc1

PDB Entry: 2c5l (more details), 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras
PDB Compounds: (C:) phosphoinositide-specific phospholipase c plc-epsilon

SCOPe Domain Sequences for d2c5lc1:

Sequence, based on SEQRES records: (download)

>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqv

Sequence, based on observed residues (ATOM records): (download)

>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]}
eesffvqvhdvspeqprtvikaprvstaqdviqqtlckakyslsilsnpnpsdyvlleev
vkdkssqrvlldqecvfqaqskwkgagkfilklkeqv

SCOPe Domain Coordinates for d2c5lc1:

Click to download the PDB-style file with coordinates for d2c5lc1.
(The format of our PDB-style files is described here.)

Timeline for d2c5lc1: