Lineage for d2c5lb_ (2c5l B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125440Domain d2c5lb_: 2c5l B: [129923]
    Other proteins in same PDB: d2c5lc1, d2c5ld_
    automated match to d1aa9__
    complexed with gol, gtp, mg

Details for d2c5lb_

PDB Entry: 2c5l (more details), 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras
PDB Compounds: (B:) gtpase hras

SCOPe Domain Sequences for d2c5lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5lb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d2c5lb_:

Click to download the PDB-style file with coordinates for d2c5lb_.
(The format of our PDB-style files is described here.)

Timeline for d2c5lb_: