SCOP 1.73: Domain d2c5lb1: 2c5l B:1-166

Lineage for d2c5lb1 (2c5l B:1-166)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (52 PDB entries)

8. Domain d2c5lb1: 2c5l B:1-166 [129923]
   Other proteins in same PDB: d2c5lc1, d2c5ld1
   automatically matched to d2q21__
   complexed with gol, gtp, mg; mutant

Details for d2c5lb1

PDB Entry: 2c5l, 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras

PDB Compounds: (B:) gtpase hras

SCOP Domain Sequences for d2c5lb1:

Sequence; same for both SEQRES and ATOM records:

>d2c5lb1 c.37.1.8 (B:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2c5lb1:

• d2c5lb1 is new in SCOP 1.73
  
• d2c5lb1 appears in SCOP 1.75
  
• d2c5lb1 appears in the current release, SCOPe 2.08, called d2c5lb_