SCOPe 2.08: Domain d2c5lb_: 2c5l B:

Lineage for d2c5lb_ (2c5l B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2c5lb_: 2c5l B: [129923]
   Other proteins in same PDB: d2c5lc1, d2c5ld_
   automated match to d1aa9__
   complexed with gol, gtp, mg

Details for d2c5lb_

PDB Entry: 2c5l, 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras

PDB Compounds: (B:) gtpase hras

SCOPe Domain Sequences for d2c5lb_:

Sequence; same for both SEQRES and ATOM records:

>d2c5lb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2c5lb_:

• d2c5lb_ first appeared in SCOP 1.73, called d2c5lb1
  
• d2c5lb_ appears in SCOPe 2.07