Lineage for d2c5la1 (2c5l A:1-166)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830050Protein cH-p21 Ras protein [52593] (1 species)
  7. 830051Species Human (Homo sapiens) [TaxId:9606] [52594] (56 PDB entries)
    Uniprot Q6P716
  8. 830066Domain d2c5la1: 2c5l A:1-166 [129922]
    Other proteins in same PDB: d2c5lc1, d2c5ld1
    automatically matched to d2q21__
    complexed with gol, gtp, mg; mutant

Details for d2c5la1

PDB Entry: 2c5l (more details), 1.9 Å

PDB Description: structure of plc epsilon ras association domain with hras
PDB Compounds: (A:) gtpase hras

SCOP Domain Sequences for d2c5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5la1 c.37.1.8 (A:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d2c5la1:

Click to download the PDB-style file with coordinates for d2c5la1.
(The format of our PDB-style files is described here.)

Timeline for d2c5la1: