Lineage for d2c5fa1 (2c5f A:4-535)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 706660Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 706661Protein Acetylcholinesterase [53476] (5 species)
  7. 706715Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (55 PDB entries)
  8. 706743Domain d2c5fa1: 2c5f A:4-535 [129914]
    automatically matched to d1eve__
    complexed with chh, nag, ndg, nwa, pge

Details for d2c5fa1

PDB Entry: 2c5f (more details), 2.6 Å

PDB Description: torpedo californica acetylcholinesterase in complex with a non hydrolysable substrate analogue, 4-oxo-n,n,n-trimethylpentanaminium
PDB Compounds: (A:) acetylcholinesterase

SCOP Domain Sequences for d2c5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5fa1 c.69.1.1 (A:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d2c5fa1:

Click to download the PDB-style file with coordinates for d2c5fa1.
(The format of our PDB-style files is described here.)

Timeline for d2c5fa1: